Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silicibacter sp. Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Silicibacter sp. Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q1GDE9

Expression Region

1-303

Origin

Silicibacter sp. (strain TM1040)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTAALLIPAMILDAAFGEPKWLWSRLPHPAVLMGKLVQALDDRLNEGDGRQVKGVIAVA VLVFVGLLLGWILSWFGSLVSVLIAAILIAQRSLIDHVRAVATGLQNDLDAGRSAVAMIV SRDTATMTGPQIARSAIESGAENFSDGVIAPAFWFLVAGLPGLLIYKLINTADSMIGYRT EAYEDFGWAAARLDDVLNILPARLSALLIALVTGRAGDWGEISADARKHRSPNAGWPEAA MARALGVALAGPRSYDGEMRPFAWVNASGSKSASAHSITRCCEVLWKSWGLALVLVVALG LLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT9 antibody
70R-2937 100 µL

NAT9 antibody

Sign In for Pricing
View Details
SCA18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43064061 1.0 µg DNA

SCA18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
C6orf64 Polyclonal Antibody, RBITC Conjugated
bs-9529R-RBITC 100 µL

C6orf64 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Human GROβ/CXCL2 (Growth Regulated Oncogene Beta) ValidElisa Kit
EK341866 96 Well

Human GROβ/CXCL2 (Growth Regulated Oncogene Beta) ValidElisa Kit

Sign In for Pricing
View Details
Dok-7 CRISPR/Cas9 KO Plasmid (m)
sc-433041 20 µg

Dok-7 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Vom1r61 (NM_001008935) Rat Tagged Lenti ORF Clone
RR203987L3 10 µg

Vom1r61 (NM_001008935) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details