Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vesicle-trafficking protein SEC22c (SEC22C)

This Recombinant Human Vesicle-trafficking protein SEC22c (SEC22C) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Vesicle-trafficking protein SEC22c, SEC22 vesicle-trafficking protein homolog C, SEC22 vesicle-trafficking protein-like 3

UniProt

Q9BRL7

Expression Region

1-303

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSI HFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQ KVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHLEPAPNFR MEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFLVPFVACIFQCYL YLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSYQILTRQLQEKQSD CGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipoprotein lipase (LPL) (NM_000237) Human Recombinant Protein
TP303766 20 µg

Lipoprotein lipase (LPL) (NM_000237) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF470 Human Gene Knockout Kit (CRISPR)
KN420720 1 Kit

ZNF470 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Manual 3 function medical bed BHBD-520
BHBD-520 1 Unit

Manual 3 function medical bed BHBD-520

Sign In for Pricing
View Details
GIRK1 (KCNJ3) (NM_002239) Human Recombinant Protein
TP762737 50 µg

GIRK1 (KCNJ3) (NM_002239) Human Recombinant Protein

Sign In for Pricing
View Details
RGMB Polyclonal Antibody
E-AB-90513-01 60 µL

RGMB Polyclonal Antibody

Sign In for Pricing
View Details
RGMB Polyclonal Antibody
E-AB-90513-02 120 µL

RGMB Polyclonal Antibody

Sign In for Pricing
View Details