Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermoplasma volcanium Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Thermoplasma volcanium Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

Q97CS1

Expression Region

1-304

Origin

Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVVLIGALSIDIIFGEPKEYIHPVVFSGRVASAIEGYFRKFDNRFRAGILFSIAVIVLT AIPYFLAVYLSSFILVVYVVVSMVILKTTFSITSMGEHIKLITDSLKKGNIMEARMHLSM IVRRDTSRLNENEISSAAIESIAEGLVDGYITPLFFFVFFGLPGAFIARIINTLDSMYGY KDRKNFEFGRFSAFMDTVINYIPARISWFFITFSSDILNYRSKAIPVRRYIRRFDSVNAG WPIASMASALNLRLEKKGHYIVNDDGYQPGVADIEKSMKIYYLAAYSYIVIFVLPLLVIM AVFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-500 1x 500 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-100 1x 100 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-100 1x 100 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Membrane (AE-5), CF647 conjugate, 0.1mg/mL
BNC470867-100 1x 100 µL

Nuclear Membrane (AE-5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details