Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans Protease HtpX homolog (htpX)

This Recombinant Bacillus halodurans Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

Q9K9E6

Expression Region

1-304

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKRILFFLLTNVLVMTTIVIVWSIISRFTNFGGSFETGGPGLGIDYASLMVFSLLVGFT GAFISLAMSRWMAKKMMNVKVLDPNGPLTERERFVVEKVHRLSRAAGLMHMPEVGIYQSA EVNAFATGPSKKRSLVAVSSGLLDAMDDDAVEGVIAHEVAHISNGDMVTMTLLQGVVNTF VVFLSRVAAIIVSRFVRSELQWIVQFAAIIVFQILFSILGSIVVSAFSRYREYHADRGGA DLAGRDKMAHALRSLKAYLDRTKLNDGTDDSAVQTMKISGRGGVMKLFSTHPDLDDRIAR LEQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), CF568 conjugate, 0.1mg/mL
BNC680732-500 1x 500 µL

TAG-72 / CA72.4 (CC49), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF568 conjugate, 0.1mg/mL
BNC682894-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (9E10.3), CF568 conjugate, 0.1mg/mL
BNC680596-100 1x 100 µL

C-Myc (9E10.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details