Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermoplasma acidophilum Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Thermoplasma acidophilum Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

Q9HLZ7

Expression Region

1-304

Origin

Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIILIGAIAIDIIFGEPKEYIHPVVFSGKVSKRIETYFRHHDNRIVYGSIFAVAVIVIT AIPYFLAIYVSSFVLVIYVIVSMVILKTTFSISAMGDHIRLVVESLKNGNISDARVYLSR VVRRDTSNLNENEISSAAIETIAEGLVDGYMTPLFFFIFLGIPGAFVARIINTLDSMCGY KDRENFEFGRFSAFMDTVINYIPARLSWFFIGFSADVLNYRHKVISPRKYVSRFDSVNAG WPISTMACALNLRLEKRGSYIVNDEGYQPSVRDIERSMHVFYVAVYSYTIIFVLPLLVAM AFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
BNC680391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-500 1x 500 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF568 conjugate, 0.1mg/mL
BNC681761-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF740 conjugate, 0.1mg/mL
BNC742418-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF568 conjugate, 0.1mg/mL
BNC682488-100 1x 100 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details