Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Leukocyte surface antigen CD47 (CD47)

This Recombinant Pongo abelii Leukocyte surface antigen CD47 (CD47) spans the amino acid sequence from region 19-323.

Product Specifications

Product Name Alternative

Leukocyte surface antigen CD47, Integrin-associated protein, IAP, CD_antigen= CD47

UniProt

Q5REL0

Expression Region

19-323

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVP TDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFS PNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLIITVIVIVGAILFV PGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLNSFVIAILVIQVIAYILAVVGLSL CIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKG MMNDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKB alpha (NFKBIA) pSer32/36 Rabbit Polyclonal Antibody
AP01617PU-N 100 µg

IKB alpha (NFKBIA) pSer32/36 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phaseolus lunatus Gel -LBA- Immobilized Lectin
AK-1701-2 2 mL

Phaseolus lunatus Gel -LBA- Immobilized Lectin

Sign In for Pricing
View Details
SNRPB Antibody
OC-139-01 50 μL

SNRPB Antibody

Sign In for Pricing
View Details
SNRPB Antibody
OC-139-02 100 µL

SNRPB Antibody

Sign In for Pricing
View Details
SNRPB Antibody
OC-139-03 1 mL

SNRPB Antibody

Sign In for Pricing
View Details
MEIS2 (NM_002399) Human Over-expression Lysate
LY419351 100 µg

MEIS2 (NM_002399) Human Over-expression Lysate

Sign In for Pricing
View Details