Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-12 (Tspan12)

This Recombinant Mouse Tetraspanin-12 (Tspan12) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Tetraspanin-12, Tspan-12, Transmembrane 4 superfamily member 12

UniProt

Q8BKT6

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGTLLVIFCVELACGVWTYEQEVM VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNYFQREFKCCGVVYFTDWLEMTEMDWPPDS CCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL TITLLWALYYDRREPGTDQMLSLKNDTSQHLSCHSVELLKPSLSRIFEHTSMANSFNTHF EMEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C9 (C9) (NM_001737) Human Over-expression Lysate
LC419774 20 µg

Complement C9 (C9) (NM_001737) Human Over-expression Lysate

Sign In for Pricing
View Details
SCH 38519
T36532 2500 μg

SCH 38519

Sign In for Pricing
View Details
Human SH3 Domain Binding Glutamate Rich Protein (SH3BGR) ELISA Kit
abx383173 96 Tests

Human SH3 Domain Binding Glutamate Rich Protein (SH3BGR) ELISA Kit

Sign In for Pricing
View Details
HP Protein (N-His, Human)
P504698 100 µg

HP Protein (N-His, Human)

Sign In for Pricing
View Details
Recombinant Arabis hirsuta Apocytochrome f (petA), partial
MBS7064075 Inquire

Recombinant Arabis hirsuta Apocytochrome f (petA), partial

Sign In for Pricing
View Details
Sin1(Phospho-Thr86) Rabbit Polyclonal Antibody
JOT-AP04751-01 20 µL

Sin1(Phospho-Thr86) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details