Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-12 (Tspan12)

This Recombinant Mouse Tetraspanin-12 (Tspan12) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Tetraspanin-12, Tspan-12, Transmembrane 4 superfamily member 12

UniProt

Q8BKT6

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGTLLVIFCVELACGVWTYEQEVM VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNYFQREFKCCGVVYFTDWLEMTEMDWPPDS CCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL TITLLWALYYDRREPGTDQMLSLKNDTSQHLSCHSVELLKPSLSRIFEHTSMANSFNTHF EMEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC9 (Histone Deacetylase 9, HD9, Histone Deacetylase 7B, HD7, HD7b, Histone deacetylase-Related Protein, MEF2-Interacting Transcription Repressor MITR, HDAC7, HDAC7B, HDRP, KIAA0744, MITR)
318454 100 µL

HDAC9 (Histone Deacetylase 9, HD9, Histone Deacetylase 7B, HD7, HD7b, Histone deacetylase-Related Protein, MEF2-Interacting Transcription Repressor MITR, HDAC7, HDAC7B, HDRP, KIAA0744, MITR)

Sign In for Pricing
View Details
Tau (S512) polyclonal antibody
E43S3738 100 µL

Tau (S512) polyclonal antibody

Sign In for Pricing
View Details
hsa-miR-380-3p miRNA Antagomir
MNH02102 2x 5.0 nmol

hsa-miR-380-3p miRNA Antagomir

Sign In for Pricing
View Details
HSBP1 Antibody, FITC conjugated
A16015-50UG 50 µg

HSBP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal ETFDH Antibody
NBP3-04957-20ul 20 µL

Rabbit Polyclonal ETFDH Antibody

Sign In for Pricing
View Details
MERS Coronavirus Spike Glycoprotein (S1), CAFc-Tag (HEK293)
REC31847-100 1 Each

MERS Coronavirus Spike Glycoprotein (S1), CAFc-Tag (HEK293)

Sign In for Pricing
View Details