Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

A6VFP2

Expression Region

1-306

Origin

Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNPIYLILADFFDRYIGEPPEKIHPVVFIGKLICFFENVFKSTNSVNKTRDLLFGFLNV ILVLAIVFFMTYEIEQIINSISNSYIKISIYSIILSFSIGHKSLIEFSKAPIKFIVNNDL EGAKKSVQCIVSRNTSELDKKHILSASIESASENITDSIIAPLIYAAIFGLPGAFLYRAV NTFDAMIGYKSEKYQYYGKTAAYLDDILNFIPSRIAGMLLIISAPFYGGNIKSAIYGYFN EGNKTPSPNSGYTMATLANSLNMELEKIGYYKLGKGEITIEKALNSLKAVDYSVLLFLII YTVLLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mast Cell Carboxypeptidase A (CPA3) Antibody
abx026386-01 80 µL

Mast Cell Carboxypeptidase A (CPA3) Antibody

Sign In for Pricing
View Details
Mast Cell Carboxypeptidase A (CPA3) Antibody
abx026386-02 400 µL

Mast Cell Carboxypeptidase A (CPA3) Antibody

Sign In for Pricing
View Details
IL-11 Protein, Human
UA040340-01 5 µg

IL-11 Protein, Human

Sign In for Pricing
View Details
IL-11 Protein, Human
UA040340-02 10 µg

IL-11 Protein, Human

Sign In for Pricing
View Details
IL-11 Protein, Human
UA040340-03 50 µg

IL-11 Protein, Human

Sign In for Pricing
View Details
IL-11 Protein, Human
UA040340-04 100 µg

IL-11 Protein, Human

Sign In for Pricing
View Details