Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

A6VFP2

Expression Region

1-306

Origin

Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNPIYLILADFFDRYIGEPPEKIHPVVFIGKLICFFENVFKSTNSVNKTRDLLFGFLNV ILVLAIVFFMTYEIEQIINSISNSYIKISIYSIILSFSIGHKSLIEFSKAPIKFIVNNDL EGAKKSVQCIVSRNTSELDKKHILSASIESASENITDSIIAPLIYAAIFGLPGAFLYRAV NTFDAMIGYKSEKYQYYGKTAAYLDDILNFIPSRIAGMLLIISAPFYGGNIKSAIYGYFN EGNKTPSPNSGYTMATLANSLNMELEKIGYYKLGKGEITIEKALNSLKAVDYSVLLFLII YTVLLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CtBP1 (Ab-422) Antibody
orb193183-01 50 μL

CtBP1 (Ab-422) Antibody

Sign In for Pricing
View Details
CtBP1 (Ab-422) Antibody
orb193183-02 100 µL

CtBP1 (Ab-422) Antibody

Sign In for Pricing
View Details
Os01g0505400 Antibody
orb840084 2 mg

Os01g0505400 Antibody

Sign In for Pricing
View Details
Cul4a Rat Pre-designed siRNA Set A
HY-RS28983 1 Set

Cul4a Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Methyl 4- (benzyloxy) -2,5-dichlorobenzoate
OR1089716-01 250 mg

Methyl 4- (benzyloxy) -2,5-dichlorobenzoate

Sign In for Pricing
View Details
Methyl 4- (benzyloxy) -2,5-dichlorobenzoate
OR1089716-02 500 mg

Methyl 4- (benzyloxy) -2,5-dichlorobenzoate

Sign In for Pricing
View Details