Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

A6VFP2

Expression Region

1-306

Origin

Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNPIYLILADFFDRYIGEPPEKIHPVVFIGKLICFFENVFKSTNSVNKTRDLLFGFLNV ILVLAIVFFMTYEIEQIINSISNSYIKISIYSIILSFSIGHKSLIEFSKAPIKFIVNNDL EGAKKSVQCIVSRNTSELDKKHILSASIESASENITDSIIAPLIYAAIFGLPGAFLYRAV NTFDAMIGYKSEKYQYYGKTAAYLDDILNFIPSRIAGMLLIISAPFYGGNIKSAIYGYFN EGNKTPSPNSGYTMATLANSLNMELEKIGYYKLGKGEITIEKALNSLKAVDYSVLLFLII YTVLLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JMJD2D, CT (Jumonji Domain Containing 2D, JMJD2D, KDM4D, Lysine-specific Demethylase 4D, JmjC Domain-containing Histone Demethylation Protein 3D, JHDM3D) (MaxLight 650) discontinued
J7876-48-ML650 100 µL

JMJD2D, CT (Jumonji Domain Containing 2D, JMJD2D, KDM4D, Lysine-specific Demethylase 4D, JmjC Domain-containing Histone Demethylation Protein 3D, JHDM3D) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Sheep T-cell surface glycoprotein CD3 epsilon chain (CD3E)
MBS966557 Inquire

Recombinant Sheep T-cell surface glycoprotein CD3 epsilon chain (CD3E)

Sign In for Pricing
View Details
TMPRSS11D Human Pre-designed siRNA Set A
HY-RS14765 1 Set

TMPRSS11D Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 beta (CCL4L2) (NM_001001435) Human Tagged ORF Clone Lentiviral Particle
RC213959L3V 200 µL

Macrophage Inflammatory Protein 1 beta (CCL4L2) (NM_001001435) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
4- (5-Nitro-2-pyridinyl) benzenecarbaldehyde
sc-299295A 1 g

4- (5-Nitro-2-pyridinyl) benzenecarbaldehyde

Sign In for Pricing
View Details
P40 phox (Neutrophil Cytosolic Factor 4, NCF4) discontinued
P1001-20D 100 µg

P40 phox (Neutrophil Cytosolic Factor 4, NCF4) discontinued

Sign In for Pricing
View Details