Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

A6VFP2

Expression Region

1-306

Origin

Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNPIYLILADFFDRYIGEPPEKIHPVVFIGKLICFFENVFKSTNSVNKTRDLLFGFLNV ILVLAIVFFMTYEIEQIINSISNSYIKISIYSIILSFSIGHKSLIEFSKAPIKFIVNNDL EGAKKSVQCIVSRNTSELDKKHILSASIESASENITDSIIAPLIYAAIFGLPGAFLYRAV NTFDAMIGYKSEKYQYYGKTAAYLDDILNFIPSRIAGMLLIISAPFYGGNIKSAIYGYFN EGNKTPSPNSGYTMATLANSLNMELEKIGYYKLGKGEITIEKALNSLKAVDYSVLLFLII YTVLLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Hydroxygeraniol, 1-Carboxylic acid, ?-D-glucopyr
MBS5795409 Inquire

8-Hydroxygeraniol, 1-Carboxylic acid, ?-D-glucopyr

Sign In for Pricing
View Details
DYN1 Antibody
orb845829 2 mg

DYN1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal IL-12/IL-23 p40 Antibody (B-P24) [Janelia Fluor 635]
NBP3-14601JF635 0.1 mL

Mouse Monoclonal IL-12/IL-23 p40 Antibody (B-P24) [Janelia Fluor 635]

Sign In for Pricing
View Details
Rabbit Monoclonal Golgi Complex Antibody (GLG1/2829R) [DyLight 755]
NBP3-08396IR 100 µL

Rabbit Monoclonal Golgi Complex Antibody (GLG1/2829R) [DyLight 755]

Sign In for Pricing
View Details
Human FBXL18 (NM_024963) AAV Particle
RC220401A1V 250 µL

Human FBXL18 (NM_024963) AAV Particle

Sign In for Pricing
View Details
STNL F003-297x420-PP-CRD/1 AC Signs
817253 Card of 1 Pictogram(s)

STNL F003-297x420-PP-CRD/1 AC Signs

Sign In for Pricing
View Details