Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor suppressor candidate 3 (Tusc3)

This Recombinant Mouse Tumor suppressor candidate 3 (Tusc3) spans the amino acid sequence from region 42-347.

Product Specifications

Product Name Alternative

Tumor suppressor candidate 3, Magnesium uptake/transporter TUSC3, Protein N33

UniProt

Q8BTV1

Expression Region

42-347

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFVKAPPRNYSMIVMFTALQPQRQCSV CRQANEEYQILANSWRYSSAFCNKLFFGMVDYDEGTDVFQQLNMNSAPTFMHFPSKGRPK RADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNN LEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAES HIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYP YSFLIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bilirubin-d4 (Major)
TRC-B385302-2.5MG 2.5 mg

Bilirubin-d4 (Major)

Sign In for Pricing
View Details
SET (NM_003011) Human Recombinant Protein
TP307606L 1 mg

SET (NM_003011) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse GM-CSF (Granulocyte-Macrophage Colony Stimulating Factor) ELISA Kit
E-EL-M0032-01 24 Tests

Mouse GM-CSF (Granulocyte-Macrophage Colony Stimulating Factor) ELISA Kit

Sign In for Pricing
View Details
Mouse GM-CSF (Granulocyte-Macrophage Colony Stimulating Factor) ELISA Kit
E-EL-M0032-02 48 Tests

Mouse GM-CSF (Granulocyte-Macrophage Colony Stimulating Factor) ELISA Kit

Sign In for Pricing
View Details
Mouse GM-CSF (Granulocyte-Macrophage Colony Stimulating Factor) ELISA Kit
E-EL-M0032-03 96 Tests

Mouse GM-CSF (Granulocyte-Macrophage Colony Stimulating Factor) ELISA Kit

Sign In for Pricing
View Details
Hamartin Antibody
KC-2280-01 50 μL

Hamartin Antibody

Sign In for Pricing
View Details