Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor suppressor candidate 3 (Tusc3)

This Recombinant Mouse Tumor suppressor candidate 3 (Tusc3) spans the amino acid sequence from region 42-347.

Product Specifications

Product Name Alternative

Tumor suppressor candidate 3, Magnesium uptake/transporter TUSC3, Protein N33

UniProt

Q8BTV1

Expression Region

42-347

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFVKAPPRNYSMIVMFTALQPQRQCSV CRQANEEYQILANSWRYSSAFCNKLFFGMVDYDEGTDVFQQLNMNSAPTFMHFPSKGRPK RADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNN LEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAES HIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYP YSFLIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Homoserine Lactone Hydrobromide
TRC-H615105-5G 5 g

L-Homoserine Lactone Hydrobromide

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: rectosigmoid
CS629952 5x 5 µm

Frozen Tissue Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
CEACAM1 Polyclonal Antibody
D-AB-10183L-01 25 µL

CEACAM1 Polyclonal Antibody

Sign In for Pricing
View Details
CEACAM1 Polyclonal Antibody
D-AB-10183L-02 100 µL

CEACAM1 Polyclonal Antibody

Sign In for Pricing
View Details
Human GFM1 activation kit by CRISPRa
GA113906 1 Kit

Human GFM1 activation kit by CRISPRa

Sign In for Pricing
View Details
Perilipin A Recombinant Rabbit Monoclonal Antibody [JM10-96]
ET1703-38 100 µL

Perilipin A Recombinant Rabbit Monoclonal Antibody [JM10-96]

Sign In for Pricing
View Details