Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Protein YIPF1 (YIPF1)

This Recombinant Pongo abelii Protein YIPF1 (YIPF1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Protein YIPF1, YIP1 family member 1

UniProt

Q5RBL0

Expression Region

1-306

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQSGSPRGSGREEDDELLGNDD SDKTELLAGQKKSSPFWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFVRLYIRSNPDL YGPFWICATLVFAIAISGNLSNFLIHLGEKTYRYVPEFRKVSIAATTIYAYAWLVPLALW GFLMWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAILWIIPQKAVRWILVMIALGISGS VLAMTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYFFDAPEMDHLPTTTATPNQTV AAAKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F-5 rabbit pAb Antibody
orb767913-01 50 μL

E2F-5 rabbit pAb Antibody

Sign In for Pricing
View Details
E2F-5 rabbit pAb Antibody
orb767913-02 100 µL

E2F-5 rabbit pAb Antibody

Sign In for Pricing
View Details
LRRC43 CRISPR Activation Plasmid (m2)
sc-436323-ACT-2 20 µg

LRRC43 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
LMAN2 Antibody Blocking peptide
orb1454935 500 µg

LMAN2 Antibody Blocking peptide

Sign In for Pricing
View Details
Mouse Krtap19-3 activation kit by CRISPRa
GA210845 1 Kit

Mouse Krtap19-3 activation kit by CRISPRa

Sign In for Pricing
View Details
PercP Anti-Human CD45RO Antibody
MBS4515070-01 20 Tests

PercP Anti-Human CD45RO Antibody

Sign In for Pricing
View Details