Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Protein YIPF1 (YIPF1)

This Recombinant Pongo abelii Protein YIPF1 (YIPF1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Protein YIPF1, YIP1 family member 1

UniProt

Q5RBL0

Expression Region

1-306

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQSGSPRGSGREEDDELLGNDD SDKTELLAGQKKSSPFWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFVRLYIRSNPDL YGPFWICATLVFAIAISGNLSNFLIHLGEKTYRYVPEFRKVSIAATTIYAYAWLVPLALW GFLMWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAILWIIPQKAVRWILVMIALGISGS VLAMTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYFFDAPEMDHLPTTTATPNQTV AAAKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akt (phospho Tyr326) Polyclonal Antibody
ABP50434-01 30 µL

Akt (phospho Tyr326) Polyclonal Antibody

Sign In for Pricing
View Details
Akt (phospho Tyr326) Polyclonal Antibody
ABP50434-02 100 µL

Akt (phospho Tyr326) Polyclonal Antibody

Sign In for Pricing
View Details
Akt (phospho Tyr326) Polyclonal Antibody
ABP50434-03 200 µL

Akt (phospho Tyr326) Polyclonal Antibody

Sign In for Pricing
View Details
TRIM37 Rabbit Polyclonal Antibody (BF594)
orb2497177 100 µL

TRIM37 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Dmrtc1b CRISPR/Cas9 KO Plasmid (m)
sc-437016 20 µg

Dmrtc1b CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
ST13P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV786477 1.0 µg DNA

ST13P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details