Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

Q6LYN9

Expression Region

1-306

Origin

Methanococcus maripaludis (strain S2 / LL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPIYLILADFFDRYIGEPPEKVHPVVFIGKLISFFENVFKSTNSVNKNRDLLFGFLNV VLVLAIVFFMAFEIEQAINSISNSYIRISLYSIILSFSIGHKSLIEFSKSPIKFIVNNDL ESAKKSVQCIVSRNTNELDKKHVLSASIESASENITDSIIAPLIYAAIFGLPGAFLYRAV NTFDAMIGYKSEKYLYYGKTAAYLDDILNFIPSRIAGMLLIISAPFYGGNVKSALLGYFN EGSKTPSPNSGYTMATLANSLSMELEKIGYYKLGKGEITVEKALNSLKAVDYSVLLFLII YMILFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF20A Rabbit Polyclonal Antibody
E28PT2470 100 µL

KIF20A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UGT1A10 Double Nickase Plasmid (m2)
sc-436494-NIC-2 20 µg

UGT1A10 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
MIIP 3'UTR Lenti-reporter-Luc Vector
28598081 1.0 µg

MIIP 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
POM121L8P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV705937 1.0 µg DNA

POM121L8P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Vav proteins Rabbit pAb
APA4943-01 30 µL

Vav proteins Rabbit pAb

Sign In for Pricing
View Details
Vav proteins Rabbit pAb
APA4943-02 50 μL

Vav proteins Rabbit pAb

Sign In for Pricing
View Details