Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

Q6LYN9

Expression Region

1-306

Origin

Methanococcus maripaludis (strain S2 / LL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPIYLILADFFDRYIGEPPEKVHPVVFIGKLISFFENVFKSTNSVNKNRDLLFGFLNV VLVLAIVFFMAFEIEQAINSISNSYIRISLYSIILSFSIGHKSLIEFSKSPIKFIVNNDL ESAKKSVQCIVSRNTNELDKKHVLSASIESASENITDSIIAPLIYAAIFGLPGAFLYRAV NTFDAMIGYKSEKYLYYGKTAAYLDDILNFIPSRIAGMLLIISAPFYGGNVKSALLGYFN EGSKTPSPNSGYTMATLANSLSMELEKIGYYKLGKGEITVEKALNSLKAVDYSVLLFLII YMILFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNN2(SK2) Rabbit Polyclonal Antibody(A244)
RA20243-01 50 µL

KCNN2(SK2) Rabbit Polyclonal Antibody(A244)

Sign In for Pricing
View Details
KCNN2(SK2) Rabbit Polyclonal Antibody(A244)
RA20243-02 100 µL

KCNN2(SK2) Rabbit Polyclonal Antibody(A244)

Sign In for Pricing
View Details
5-Bromobicyclo[4.2.0]octa-1 (6),2,4-triene-7-carbonitrile
SJA47351-01 50 mg

5-Bromobicyclo[4.2.0]octa-1 (6),2,4-triene-7-carbonitrile

Sign In for Pricing
View Details
5-Bromobicyclo[4.2.0]octa-1 (6),2,4-triene-7-carbonitrile
SJA47351-02 0.5 g

5-Bromobicyclo[4.2.0]octa-1 (6),2,4-triene-7-carbonitrile

Sign In for Pricing
View Details
INSL3 / RLF (Human) - I-125 Labeled Purified IgG
T-G-035-27 10 µCi

INSL3 / RLF (Human) - I-125 Labeled Purified IgG

Sign In for Pricing
View Details
Human CGREF1 Protein Lysate
MBS139372-01 0.02 mg

Human CGREF1 Protein Lysate

Sign In for Pricing
View Details