Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein YIPF1 (Yipf1)

This Recombinant Mouse Protein YIPF1 (Yipf1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Protein YIPF1, YIP1 family member 1

UniProt

Q91VU1

Expression Region

1-306

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVDDLQFEEFGDGATLLAANPDATTINIEDPSVSFGHQPRPPGSVGREEDEELLGNND SDETELLAGQKRSSPFWTFEYYQTFFDVDTYQVFDRIKGSLLPVPGKNFVRLYIRSNPDL YGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFQKVSIAATVIYAYAWLVPLALW GFLLWRNSKVMSMVSYSFLEIVCVYGYSLFIYIPTAVLWIIPQRVVRWVLVMIALGVSGS VLVMTFWPAVREDNRRVALATIVTIVLLHVLLSVGCLAYFFDAPEMDHLPAAITTPNQTV TAAKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRD sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1757705 3x 1.0 µg

PTPRD sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
HYDRAZINE250X26CARD-T1-P21 Pipe Markers for Acids & Bases
N001875 4 Card (4 Marker (s) x 1 Card)

HYDRAZINE250X26CARD-T1-P21 Pipe Markers for Acids & Bases

Sign In for Pricing
View Details
Bcap31 3'UTR Luciferase Stable Cell Line
TU102662 1.0 mL

Bcap31 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis)
MBS4380629-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

MMP3 (Marker of Metastasis and Rheumatoid Arthritis)

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis)
MBS4380629-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

MMP3 (Marker of Metastasis and Rheumatoid Arthritis)

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis)
MBS4380629-03 0.1 mg (Without BSA & Azide at 1mg/mL)

MMP3 (Marker of Metastasis and Rheumatoid Arthritis)

Sign In for Pricing
View Details