Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein YIPF1 (YIPF1)

This Recombinant Human Protein YIPF1 (YIPF1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Protein YIPF1, YIP1 family member 1

UniProt

Q9Y548

Expression Region

1-306

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQPGSPRGSGREEDDELLGNDD SDKTELLAGQKKSSPFWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFVRLYIRSNPDL YGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALW GFLMWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAILWIIPQKAVRWILVMIALGISGS LLAMTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYFFDAPEMDHLPTTTATPNQTV AAAKSS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ruthenium 5% On Alumina
R02840-01 10 g

Ruthenium 5% On Alumina

Sign In for Pricing
View Details
Ruthenium 5% On Alumina
R02840-02 100 g

Ruthenium 5% On Alumina

Sign In for Pricing
View Details
Ikbkb (NM_001159774) Mouse Tagged ORF Clone
MR210500 10 µg

Ikbkb (NM_001159774) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human CDC37L1 shRNA (UAS) - Lentiviral human CDC37L1 shRNA (UAS, iRFP) (25)
GTR15079274 1 Vial

Lentiviral human CDC37L1 shRNA (UAS) - Lentiviral human CDC37L1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Anti-NBL4 antibody
STJ71407 100 µg

Anti-NBL4 antibody

Sign In for Pricing
View Details
Rabbit Polyclonal DLGAP2 Antibody [Alexa Fluor 750]
NBP2-82086AF750 0.1 mL

Rabbit Polyclonal DLGAP2 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details