Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Vesicle-trafficking protein SEC22a (SEC22A)

This Recombinant Macaca fascicularis Vesicle-trafficking protein SEC22a (SEC22A) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Vesicle-trafficking protein SEC22a, SEC22 vesicle-trafficking protein homolog A

UniProt

Q4R866

Expression Region

1-307

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNI NFISSLGVSYMMLCTDNYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ RTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISS AHQRLEPATLSGIVGFILSLLCGALNLIRGFHAIESLLQSDGDDFNYIIAFFLGTAACLY QCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG KAPDYDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
BNC880177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-DRB (LN-3 + HLA-DRB/1067), CF594 conjugate, 0.1mg/mL
BNC941208-500 1x 500 µL

HLA-DRB (LN-3 + HLA-DRB/1067), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF568 conjugate, 0.1mg/mL
BNC682884-500 1x 500 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF594 conjugate, 0.1mg/mL
BNC941981-500 1x 500 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details