Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Methanocaldococcus jannaschii Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

Q58710

Expression Region

1-307

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNPIILFLAIIFDRIIGELPESIHPTVWIGKLIAFLENIFKSTNCKNKYRDFLFGSLTT FITLLVVGVIAFFVDKCIMLLPFPLNYIIYGFLLSTTIGYKSLFEFCKKPIEYIKNGDLE GARKAVQHIVSRDASKLDKEHVLSAAVESLSENITDSIIGALFYAIFFGLPGAFVYRAIN TLDAMIGYKNEKYLWYGKLAARLDDIANFIPSRIAGILLIITAPFYKGDVKKAIYGFLKE ANKVPSPNSGYTMATLANALNITLEKIGYYKLGSGKIDVEKSLNAFKAVDYTVVVFLIIY TLIWWIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynorphin A (1-8) Porcine Peptide
PE-88373-01 1 mg

Dynorphin A (1-8) Porcine Peptide

Sign In for Pricing
View Details
Dynorphin A (1-8) Porcine Peptide
PE-88373-02 5 mg

Dynorphin A (1-8) Porcine Peptide

Sign In for Pricing
View Details
Dynorphin A (1-8) Porcine Peptide
PE-88373-03 10 mg

Dynorphin A (1-8) Porcine Peptide

Sign In for Pricing
View Details
Human UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit
MBS2509926-01 24 Tests

Human UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit

Sign In for Pricing
View Details
Human UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit
MBS2509926-02 48 Tests

Human UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit

Sign In for Pricing
View Details
Human UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit
MBS2509926-03 96 Tests

Human UBE1L (Ubiquitin Activating Enzyme E1 Like Protein) ELISA Kit

Sign In for Pricing
View Details