Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle-trafficking protein SEC22a (Sec22a)

This Recombinant Mouse Vesicle-trafficking protein SEC22a (Sec22a) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Vesicle-trafficking protein SEC22a, SEC22 vesicle-trafficking protein homolog A, SEC22 vesicle-trafficking protein-like 2

UniProt

Q8BH47

Expression Region

1-307

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQFPDRCTLKTGRYNI NFISSLGVSYMMLCSENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ RTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKISS AHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDLNYIIAFFLGTAACLY QCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG KAPDHDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA Membrane Filter, Pore:0.8(μm), Diameter: 25(mm)
FBM025CA080 3 x 200 Membrane Filters

CA Membrane Filter, Pore:0.8(μm), Diameter: 25(mm)

Sign In for Pricing
View Details
HDAC3 Rabbit Monoclonal Antibody [Clone ID: R03-4J9]
TA421419 100 µL

HDAC3 Rabbit Monoclonal Antibody [Clone ID: R03-4J9]

Sign In for Pricing
View Details
UBTF Protein Vector (Mouse) (pPM-C-HA)
PV243828 500 ng

UBTF Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TMEM223 Protein Vector (Mouse) (pPB-N-His)
PV239559 500 ng

TMEM223 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Xylometazoline hydrochloride
orb1310993-01 1 g

Xylometazoline hydrochloride

Sign In for Pricing
View Details
Xylometazoline hydrochloride
orb1310993-02 1 ml x 10 mM (in DMSO)

Xylometazoline hydrochloride

Sign In for Pricing
View Details