Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle-trafficking protein SEC22a (Sec22a)

This Recombinant Mouse Vesicle-trafficking protein SEC22a (Sec22a) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Vesicle-trafficking protein SEC22a, SEC22 vesicle-trafficking protein homolog A, SEC22 vesicle-trafficking protein-like 2

UniProt

Q8BH47

Expression Region

1-307

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQFPDRCTLKTGRYNI NFISSLGVSYMMLCSENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ RTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKISS AHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDLNYIIAFFLGTAACLY QCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG KAPDHDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ticlopidine hydrochloride
orb1310688-01 200 mg

Ticlopidine hydrochloride

Sign In for Pricing
View Details
Ticlopidine hydrochloride
orb1310688-02 1 ml x 10 mM (in DMSO)

Ticlopidine hydrochloride

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF276 Antibody [DyLight 550]
NBP1-03342R 0.1 mL

Rabbit Polyclonal ZNF276 Antibody [DyLight 550]

Sign In for Pricing
View Details
RHBDL1 Lentiviral Activation Particles (h)
sc-405676-LAC 200 µL

RHBDL1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Goat Anti-Human IgG Fd-BIOT
2046-08 0.5 mg

Goat Anti-Human IgG Fd-BIOT

Sign In for Pricing
View Details
Human Hepcidin (HAMP) ELISA Kit
GTR10478916-01 48 Well

Human Hepcidin (HAMP) ELISA Kit

Sign In for Pricing
View Details