Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle-trafficking protein SEC22a (Sec22a)

This Recombinant Mouse Vesicle-trafficking protein SEC22a (Sec22a) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Vesicle-trafficking protein SEC22a, SEC22 vesicle-trafficking protein homolog A, SEC22 vesicle-trafficking protein-like 2

UniProt

Q8BH47

Expression Region

1-307

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQFPDRCTLKTGRYNI NFISSLGVSYMMLCSENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ RTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKISS AHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDLNYIIAFFLGTAACLY QCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG KAPDHDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRM1 Antibody Blocking Peptide
orb1509624 500 µg

GRM1 Antibody Blocking Peptide

Sign In for Pricing
View Details
Guinea Pig Bestrophin 3 (BEST3) ELISA Kit
GTR10334922 96 Well

Guinea Pig Bestrophin 3 (BEST3) ELISA Kit

Sign In for Pricing
View Details
RGD1311307 3'UTR Lenti-reporter-Luc Vector
66823086 1.0 µg

RGD1311307 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mosapride Lactose Impurity 57
RM-M191657-01 10 mg

Mosapride Lactose Impurity 57

Sign In for Pricing
View Details
Mosapride Lactose Impurity 57
RM-M191657-02 100 mg

Mosapride Lactose Impurity 57

Sign In for Pricing
View Details
Mosapride Lactose Impurity 57
RM-M191657-03 25 mg

Mosapride Lactose Impurity 57

Sign In for Pricing
View Details