Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Glycoprotein K (gK)

This Recombinant Human herpesvirus 1 Glycoprotein K (gK) spans the amino acid sequence from region 31-338.

Product Specifications

Product Name Alternative

Glycoprotein K, gK, Syncytial protein

UniProt

P03178

Expression Region

31-338

Origin

Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASPLHRCIYAVRPTGTNNDTALVWMKMNQTLLFLGAPTHPPNGGWRNHAHISYANLIAGR VVPFQVPPDATNRRIMNVHEAVNCLETLWYTRVRLVVVGWFLYLAFVALHQRRCMFGVVS PAHKMVAPATYLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQNLVQLFETDPVTFLYH RPAIGVIVGCELIVRFVAVGLIVGTAFISRGACAITYPLFLTITTWCFVSTIGLTELYCI LRRGPAPKNADKAAAPGRSKGLSGVCGRCCSIILSGIAMRLCYIAVVAGVVLVALHYEQE IQRRLFDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-100 1x 100 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9 + S100B/1012), 0.2mg/mL
BNC041204-500 1x 500 µL

S100B (4C4.9 + S100B/1012), 0.2mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/775), CF647 conjugate, 0.1mg/mL
BNC470775-500 1x 500 µL

Pgp9.5 (UCHL-1) (UCHL1/775), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF740 conjugate, 0.1mg/mL
BNC742035-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), CF594 conjugate, 0.1mg/mL
BNC941680-100 1x 100 µL

CD45RA (Leukocyte Marker) (K4B5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CTC05), CF640R conjugate, 0.1mg/mL
BNC400887-500 1x 500 µL

Cytochrome C (CTC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details