Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Dual oxidase maturation factor 1 (duoxa1)

This Recombinant Xenopus tropicalis Dual oxidase maturation factor 1 (duoxa1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Dual oxidase maturation factor 1, Dual oxidase activator 1

UniProt

Q0P4G7

Expression Region

1-308

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQANIFPFYPQPRTSFKFDTKIIEIIIICIVTACTFIIILPGIRGKSRSIWLFRILTSLF IGAVILAVNFTSDWETGIVTATTVYKSFSHSMLNASIGLWIGLKGVNITLIGNPVYQLNE TINYNEEFAWESANQFDKNYKDGLERGLPYPILYVAEKFTINSPCGLFQQYCISTYYSSE IMWVAFGSWILYNVLFSMPVILYGICMMFVTAICMLVSLISFASVRQAPVCNIHFGNAVL KTHFGVSYWLSLVTGLFCLIVSLVLLFLYKTQPKVIRLIFSYGEEEDLSDKSENEEEHSS ALSLNEML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-100 1x 100 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details