Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. Ycf92-like protein (alr0484)

This Recombinant Nostoc sp. Ycf92-like protein (alr0484) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Ycf92-like protein

UniProt

Q8YZH6

Expression Region

1-308

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLLRSLPLGLYLEQPQTWLHKLDPRVKFIWLMSFLTSYSFANNLWRILLVALLILFTLI ARIPRRVWQQQMGWLLTLSFFVLAIAAISPDGLGVDYQSRLPTNPQVLTQSANTNNSATA TEQLKSSKSYTYVLFHKGPVKVTRRSLDLAVRISTIIFTVIYSTNLYLLTTAPEEITAGV ESLMQPLRRFKIPVTEITLTLTLSLRFIPLVLEEVQNLVRSVMTRAINWKKLGLKGAVKV WMIVAERLLENLLLRASQMASAMMVRGFTSPNEHRVPWHDLRLKLRDWLAIASLTIFWGI RVVFGNQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-500 1x 500 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-500 1x 500 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (HJ21), CF405S conjugate, 0.1mg/mL
BNC040984-500 1x 500 µL

P21 / WAF1 (HJ21), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details