Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable palmitoyltransferase ZDHHC19 (ZDHHC19)

This Recombinant Human Probable palmitoyltransferase ZDHHC19 (ZDHHC19) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Probable palmitoyltransferase ZDHHC19, EC= 2.3.1.-, Zinc finger DHHC domain-containing protein 19, DHHC-19

UniProt

Q8WVZ1

Expression Region

1-309

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWA FPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFH RPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLV RTTHLPFSTDKAIAIVVAVSAAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFD QGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNLHPPMSPSALNPPAPTSGSLQ SREGTPGAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-30 protein (N-His)
PKSH034115-01 20 µg

Recombinant Human IL-30 protein (N-His)

Sign In for Pricing
View Details
Recombinant Human IL-30 protein (N-His)
PKSH034115-02 100 µg

Recombinant Human IL-30 protein (N-His)

Sign In for Pricing
View Details
FLCN Recombinant Rabbit monoclonal Antibody
HA751180 100 µL

FLCN Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Sim2 Mouse Gene Knockout Kit (CRISPR)
KN515790 1 Kit

Sim2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARMCX2 (NM_014782) Human Over-expression Lysate
LY402377 100 µg

ARMCX2 (NM_014782) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Anti-Human CD74 Antibody[LN2]
E-AB-F1072E-01 20 Tests

APC Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details