Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable palmitoyltransferase ZDHHC19 (ZDHHC19)

This Recombinant Human Probable palmitoyltransferase ZDHHC19 (ZDHHC19) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Probable palmitoyltransferase ZDHHC19, EC= 2.3.1.-, Zinc finger DHHC domain-containing protein 19, DHHC-19

UniProt

Q8WVZ1

Expression Region

1-309

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWA FPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFH RPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLV RTTHLPFSTDKAIAIVVAVSAAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFD QGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNLHPPMSPSALNPPAPTSGSLQ SREGTPGAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EAUCH.PRIM.250X26CARD-T1-P16 Pipe Markers for Water
N003365 4 Card (4 Marker (s) x 1 Card)

EAUCH.PRIM.250X26CARD-T1-P16 Pipe Markers for Water

Sign In for Pricing
View Details
2200002K05Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3491003 1.0 µg DNA

2200002K05Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Lentiviral mouse Rhou shRNA (UAS) - Lentiviral mouse Rhou shRNA (UAS, iRFP) plasmid
GTR15196360 1 Vial

Lentiviral mouse Rhou shRNA (UAS) - Lentiviral mouse Rhou shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
FAM47A antibody
70R-4204 100 µL

FAM47A antibody

Sign In for Pricing
View Details
Wnt3a Rat shRNA Plasmid (Locus ID 303181)
TL705577 1 Kit

Wnt3a Rat shRNA Plasmid (Locus ID 303181)

Sign In for Pricing
View Details
PCBP2 Rabbit pAb, BF700 conjugated
orb2864809 100 µL

PCBP2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details