Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable palmitoyltransferase ZDHHC19 (ZDHHC19)

This Recombinant Human Probable palmitoyltransferase ZDHHC19 (ZDHHC19) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Probable palmitoyltransferase ZDHHC19, EC= 2.3.1.-, Zinc finger DHHC domain-containing protein 19, DHHC-19

UniProt

Q8WVZ1

Expression Region

1-309

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWA FPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFH RPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLV RTTHLPFSTDKAIAIVVAVSAAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFD QGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNLHPPMSPSALNPPAPTSGSLQ SREGTPGAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O1:K1/APEC MIAA Polyclonal Antibody
MBS7142464 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC MIAA Polyclonal Antibody

Sign In for Pricing
View Details
Sumo2/3 Recombinant Antibody, PE-Cy7 Conjugated
bsm-61351R-PE-Cy7-01 20 µL

Sumo2/3 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Sumo2/3 Recombinant Antibody, PE-Cy7 Conjugated
bsm-61351R-PE-Cy7-02 100 µL

Sumo2/3 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
HORMAD1 Polyclonal Antibody
RA26024-01 50 µL

HORMAD1 Polyclonal Antibody

Sign In for Pricing
View Details
HORMAD1 Polyclonal Antibody
RA26024-02 100 µL

HORMAD1 Polyclonal Antibody

Sign In for Pricing
View Details
NUTF2 Rabbit pAb
E45R20158N 50 ul

NUTF2 Rabbit pAb

Sign In for Pricing
View Details