Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Sporulation sigma-E factor-processing peptidase (spoIIGA)

This Recombinant Bacillus subtilis Sporulation sigma-E factor-processing peptidase (spoIIGA) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Sporulation sigma-E factor-processing peptidase, EC= 3.4.23.-, Stage II sporulation protein GA

UniProt

P13801

Expression Region

1-309

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIYLDVIWLLNFCFDALLLLLTAFILKRHVKKRRLVGGAFIGSSIVLLMFTPFSPIVEH PAGKLAFSVVIVVVTFGFKRFRFFFQNLFSFYFATFLMGGGIIGAHSLLQSNSIVQNGVM ITNQTGFGDPISWLFIVGGFPALWFFSKRRIEDIETKNIQYEERVSVQADLGSQTLHVRG LIDSGNQLYDPLTKTPVMIIYIDKLEPIFGTAETMIIRNTDPLEAIEQLDDSFRFLDKMR LIPYRGVGQQNQFLLCVKPDHVTIMTKEEMISADKCLIGISTTKLSADGEFDAIIHPKML SGKAVKHVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TENM4 shRNA (UAS) - Lentiviral human TENM4 shRNA (UAS, GFP) (25)
GTR15310475 1 Vial

Lentiviral human TENM4 shRNA (UAS) - Lentiviral human TENM4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rpl34-ps1 Protein Vector (Mouse) (pPB-N-His)
PV225407 500 ng

Rpl34-ps1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral mouse Taar5 shRNA (UAS) - Lentiviral mouse Taar5 shRNA (UAS, GFP) plasmid
GTR15284086 1 Vial

Lentiviral mouse Taar5 shRNA (UAS) - Lentiviral mouse Taar5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human SMIM29 Pre-designed siRNA Set B
SI015336B 1 Each

Human SMIM29 Pre-designed siRNA Set B

Sign In for Pricing
View Details
EPAS1 (Endothelial PAS Domain Protein 1, ECYT4, HIF2A, HLF, MOP2, PASD2, bHLHe73) (PE)
MBS6187430-01 0.1 mL

EPAS1 (Endothelial PAS Domain Protein 1, ECYT4, HIF2A, HLF, MOP2, PASD2, bHLHe73) (PE)

Sign In for Pricing
View Details
EPAS1 (Endothelial PAS Domain Protein 1, ECYT4, HIF2A, HLF, MOP2, PASD2, bHLHe73) (PE)
MBS6187430-02 5x 0.1 mL

EPAS1 (Endothelial PAS Domain Protein 1, ECYT4, HIF2A, HLF, MOP2, PASD2, bHLHe73) (PE)

Sign In for Pricing
View Details