Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Sporulation sigma-E factor-processing peptidase (spoIIGA)

This Recombinant Bacillus subtilis Sporulation sigma-E factor-processing peptidase (spoIIGA) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Sporulation sigma-E factor-processing peptidase, EC= 3.4.23.-, Stage II sporulation protein GA

UniProt

P13801

Expression Region

1-309

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIYLDVIWLLNFCFDALLLLLTAFILKRHVKKRRLVGGAFIGSSIVLLMFTPFSPIVEH PAGKLAFSVVIVVVTFGFKRFRFFFQNLFSFYFATFLMGGGIIGAHSLLQSNSIVQNGVM ITNQTGFGDPISWLFIVGGFPALWFFSKRRIEDIETKNIQYEERVSVQADLGSQTLHVRG LIDSGNQLYDPLTKTPVMIIYIDKLEPIFGTAETMIIRNTDPLEAIEQLDDSFRFLDKMR LIPYRGVGQQNQFLLCVKPDHVTIMTKEEMISADKCLIGISTTKLSADGEFDAIIHPKML SGKAVKHVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 Antibody
orb2638768 100 µg

Cytokeratin 18 Antibody

Sign In for Pricing
View Details
Recombinant Human XIAP Protein, N-His
orb3148870-01 50 µg

Recombinant Human XIAP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human XIAP Protein, N-His
orb3148870-02 100 µg

Recombinant Human XIAP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human XIAP Protein, N-His
orb3148870-03 1 mg

Recombinant Human XIAP Protein, N-His

Sign In for Pricing
View Details
Secreted Frizzled Related Protein 1 (SFRP1) Magnetic Fluorescence Assay Kit
MBS2160297-01 96 Tests

Secreted Frizzled Related Protein 1 (SFRP1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Secreted Frizzled Related Protein 1 (SFRP1) Magnetic Fluorescence Assay Kit
MBS2160297-02 5x 96 Tests

Secreted Frizzled Related Protein 1 (SFRP1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details