Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Sporulation sigma-E factor-processing peptidase (spoIIGA)

This Recombinant Bacillus subtilis Sporulation sigma-E factor-processing peptidase (spoIIGA) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Sporulation sigma-E factor-processing peptidase, EC= 3.4.23.-, Stage II sporulation protein GA

UniProt

P13801

Expression Region

1-309

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIYLDVIWLLNFCFDALLLLLTAFILKRHVKKRRLVGGAFIGSSIVLLMFTPFSPIVEH PAGKLAFSVVIVVVTFGFKRFRFFFQNLFSFYFATFLMGGGIIGAHSLLQSNSIVQNGVM ITNQTGFGDPISWLFIVGGFPALWFFSKRRIEDIETKNIQYEERVSVQADLGSQTLHVRG LIDSGNQLYDPLTKTPVMIIYIDKLEPIFGTAETMIIRNTDPLEAIEQLDDSFRFLDKMR LIPYRGVGQQNQFLLCVKPDHVTIMTKEEMISADKCLIGISTTKLSADGEFDAIIHPKML SGKAVKHVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK 1 Polyclonal Antibody
MBS9243591-01 0.1 mL

ERK 1 Polyclonal Antibody

Sign In for Pricing
View Details
ERK 1 Polyclonal Antibody
MBS9243591-02 5x 0.1 mL

ERK 1 Polyclonal Antibody

Sign In for Pricing
View Details
PALM2 (Paralemmin 2, Paralemmin-2) (MaxLight 490)
MBS6388377-01 0.1 mL

PALM2 (Paralemmin 2, Paralemmin-2) (MaxLight 490)

Sign In for Pricing
View Details
PALM2 (Paralemmin 2, Paralemmin-2) (MaxLight 490)
MBS6388377-02 5x 0.1 mL

PALM2 (Paralemmin 2, Paralemmin-2) (MaxLight 490)

Sign In for Pricing
View Details
Human SERPINA12 Pre-designed siRNA Set B
SI014557B 1 Each

Human SERPINA12 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cyclin D1 Antibody
MBS9503530-01 0.05 mL

Cyclin D1 Antibody

Sign In for Pricing
View Details