Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus solfataricus Protease HtpX homolog 1 (htpX1)

This Recombinant Sulfolobus solfataricus Protease HtpX homolog 1 (htpX1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Protease HtpX homolog 1, EC= 3.4.24.-

UniProt

Q97X95

Expression Region

1-311

Origin

Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVRQRLISSMVISLGLTIISEGIVLIGIASLLHISLFFIFPALVIFWLFQWIISPYVVG RGGYEVSPNDPQYGWLYNLVRRIAEESKIKPPRVFVIDAPYPNAFAYGNRLGGMRVGITL PLLNILDVDELTAVIAHEVGHIKHRDVEIGMTIGLIPTVLGYISTLLMNFGYLALFLAAD EIELLFAIAALAIGFVIFVVTFILQIFVLWFNRLRESYADYNSFLVLGEGSKALATALAK IEIYMQNIRIDPFTGIIVTAPPVKVEEKDPHLLVEQWLRTKVSAFKDILSTHPYPARRAQ MIYRLIYGSNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-100 1x 100 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details