Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chromobacterium violaceum Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Chromobacterium violaceum Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q7NXQ1

Expression Region

1-312

Origin

Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSALFLPIALLLDRLLGEPPRWHPLVGFGRLVKAVERAAYPAAPGAEPVWRMRLRGAAA IALLLAPFTLAAWALARLPLLEIIVPVALLYLAVGARSLAQHAEVVRKALAEGDLQLARE RVGWIVSRDTRELDEAGVARATIESVLENGSDAVFAALFWFLVLGAPGAVLYRLANTLDA MWGYKNERYLHFGWAAARFDDMLNYLPARLTALTYLLLGHAAKGWRCWRTQAPTWYSPNA GPVMAAGAGALGVSLGGGARYHGQWKERPPLGCGPTPTHEDIGRAVRLVNRGMWLWAALS LAAAILIGAIHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Arl8b activation kit by CRISPRa
GA207179 1 Kit

Mouse Arl8b activation kit by CRISPRa

Sign In for Pricing
View Details
Calpain 1 (CAPN1/1530), CF740 conjugate, 0.1mg/mL
BNC741530-100 1x 100 µL

Calpain 1 (CAPN1/1530), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-(2,3-Dichlorophenyl)piperazine Hydrochloride
TRC-D435750-50MG 50 mg

N-(2,3-Dichlorophenyl)piperazine Hydrochloride

Sign In for Pricing
View Details
Rat Complement Component 3 (C3) ELISA Kit
RD-C3-Ra-01 96 Tests

Rat Complement Component 3 (C3) ELISA Kit

Sign In for Pricing
View Details
Rat Complement Component 3 (C3) ELISA Kit
RD-C3-Ra-02 48 Tests

Rat Complement Component 3 (C3) ELISA Kit

Sign In for Pricing
View Details
CD4, Mouse (T-Cell Marker) (GK1.5), 0.2mg/mL
BNUB2009-500 1x 500 µL

CD4, Mouse (T-Cell Marker) (GK1.5), 0.2mg/mL

Sign In for Pricing
View Details