Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein YIPF2 (Yipf2)

This Recombinant Mouse Protein YIPF2 (Yipf2) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Protein YIPF2, YIP1 family member 2

UniProt

Q99LP8

Expression Region

1-312

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAADELAFHEFEEATNLLAETPDAATTSQSDELTSREHVAVVVGSGIGYGAEVGEEEDD KTSLLQEEKPQPRFWTFDYYQSFFDVDTSQVLDRIKGSLLPHPGHNFVRHHLRNRPDLYG PFWICATLAFVLAVTGNLTLVLAQRRDPSIHYSPQFHKVTIAGITIYCYAWLVPLALWGF LRWRQGTRERMGLYTFLETVCVYGYSLFVFIPTVVLWLIPVQWIQWLFGALGLALSAAGL VFTLWPVVREDTRLVAAALLSTVVLLHALLALGCKLYFFQPLPLDHVVPAPQATPPSPNV LLPSSIQPMTTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSD Rabbit Polyclonal Antibody
orb625450-01 50 µg

CTSD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTSD Rabbit Polyclonal Antibody
orb625450-02 100 µg

CTSD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AK3P6 Protein Vector (Human) (pPB-N-His)
PV061678 500 ng

AK3P6 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
KITLG Polyclonal Antibody
MBS8570918-01 0.1 mL

KITLG Polyclonal Antibody

Sign In for Pricing
View Details
KITLG Polyclonal Antibody
MBS8570918-02 0.1 mL (AF405L)

KITLG Polyclonal Antibody

Sign In for Pricing
View Details
KITLG Polyclonal Antibody
MBS8570918-03 0.1 mL (AF405S)

KITLG Polyclonal Antibody

Sign In for Pricing
View Details