Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 1 Glycoprotein K (gK)

This Recombinant Equine herpesvirus 1 Glycoprotein K (gK) spans the amino acid sequence from region 32-343.

Product Specifications

Product Name Alternative

Glycoprotein K, gK, Syncytial protein

UniProt

P68334

Expression Region

32-343

Origin

Equine herpesvirus 1 (strain Kentucky A) (EHV-1) (Equine abortion virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LHNPCVYATVSIDSKDGIAAKWEVYNSTIVYAYPENGAKRFSDGLSGFDYVCRENWVNES KLDVLKNMKELHDKVRIVVGTRNCRAYLWSVQLQMITGAWLIYIAFLCLRQERRLLGPFR NQNEFLSPTGYTFNYATYTLATTVLKTHYTKFALLLCEASLRRVALSRTFKRDPIGFLCE HSAALALIGLEVGTHFVARLLVVGTVTLVHTPCSQIYPIYLKLASWGFVVAVTIVEIVAI IYEKPPKTGSSANPPTPATHGVKGLCTSCCSTVLANLCGKLVYLLLVIGAVSILLHYEQR IQIGLLGESFSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-500 1x 500 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/1593), CF405S conjugate, 0.1mg/mL
BNC041593-500 1x 500 µL

Aurora B (Proliferation Marker) (AURKB/1593), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF594 conjugate, 0.1mg/mL
BNC942427-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details