Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Fibroblast growth factor 2 (FGF2)

Product Specifications

Product Name Alternative

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Abbreviation

Recombinant Chicken FGF2 protein

Gene Name

FGF2

UniProt

P48800

Expression Region

13-158aa

Organism

Gallus gallus (Chicken)

Target Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Cancer

Relevance

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA DOB (HLA-DOB) (NM_002120) Human Over-expression Lysate
LC400772 20 µg

HLA DOB (HLA-DOB) (NM_002120) Human Over-expression Lysate

Sign In for Pricing
View Details
ATP6V1C1 (NM_001695) Human Over-expression Lysate
LC419795 20 µg

ATP6V1C1 (NM_001695) Human Over-expression Lysate

Sign In for Pricing
View Details
Giardia lamblia (BB1.1E5), CF568 conjugate, 0.1mg/mL
BNC680210-100 1x 100 µL

Giardia lamblia (BB1.1E5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS704153 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS646433 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Anoctamin 3 (ANO3) Human Gene Knockout Kit (CRISPR)
KN423382 1 Kit

Anoctamin 3 (ANO3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details