Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Fibroblast growth factor 2 (FGF2)

Product Specifications

Product Name Alternative

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Abbreviation

Recombinant Chicken FGF2 protein

Gene Name

FGF2

UniProt

P48800

Expression Region

13-158aa

Organism

Gallus gallus (Chicken)

Target Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Cancer

Relevance

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp5 Mouse Gene Knockout Kit (CRISPR)
KN518808 1 Kit

Usp5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RNF156 (MGRN1) (NM_015246) Human Recombinant Protein
TP308284 20 µg

RNF156 (MGRN1) (NM_015246) Human Recombinant Protein

Sign In for Pricing
View Details
HBSA *Optimized for Maximum Immunization Response*
5601-AAT 10 mg

HBSA *Optimized for Maximum Immunization Response*

Sign In for Pricing
View Details
Antxr1 Mouse Gene Knockout Kit (CRISPR)
KN501327 1 Kit

Antxr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ZNF627 activation kit by CRISPRa
GA116309 1 Kit

Human ZNF627 activation kit by CRISPRa

Sign In for Pricing
View Details
UDP-3-O[R-3-Hydroxymyristoyl]-N-acetylglucosamine Tris Salt (90%)
TRC-U250525-5MG 5 mg

UDP-3-O[R-3-Hydroxymyristoyl]-N-acetylglucosamine Tris Salt (90%)

Sign In for Pricing
View Details