Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q7VEN1

Expression Region

1-313

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFASIWQTRAVGVLIGCLLDVVFGDPKRGHPVALFGRAAAKLEQITYRDGRVAGAVHVGL LVGAVGLLGAALQRLPGRCWPVAATATATWAALGGTSLARTGRQISDLLERDDVEAARRL LPSLCGRDPAQLGGPGLTRAALESVAENTADAQVVPLLWAASSGVPAVLGYRAINTLDSM IGYRSPRYLRFGWAAARLDDWANYVGARATAVLVVICAPVVGGSPRGAVRAWRRDAARHP SPNAGVVEAAFAGALDVRLGGPTRYHHELQIRPTLGDGRSPKVADLRRAVVLSRVVQAGA AVLAVMLVYRRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBPL1 Rabbit pAb, AP conjugated
orb2887051 100 µL

IGFBPL1 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal CBR3 Antibody [DyLight 755]
NBP3-00346IR 0.1 mL

Rabbit Polyclonal CBR3 Antibody [DyLight 755]

Sign In for Pricing
View Details
TBK1 (TANK-Binding Kinase 1, NFkB Activating Kinase, NAK, T2K) discontinued
213701-01 20 µL

TBK1 (TANK-Binding Kinase 1, NFkB Activating Kinase, NAK, T2K) discontinued

Sign In for Pricing
View Details
TBK1 (TANK-Binding Kinase 1, NFkB Activating Kinase, NAK, T2K) discontinued
213701-02 100 µL

TBK1 (TANK-Binding Kinase 1, NFkB Activating Kinase, NAK, T2K) discontinued

Sign In for Pricing
View Details
2-[1- (3-Chlorophenyl) -5-methyl-1H-1,2,3-triazol-4-yl]acetic acid
SQB45761-01 50 mg

2-[1- (3-Chlorophenyl) -5-methyl-1H-1,2,3-triazol-4-yl]acetic acid

Sign In for Pricing
View Details
2-[1- (3-Chlorophenyl) -5-methyl-1H-1,2,3-triazol-4-yl]acetic acid
SQB45761-02 0.5 g

2-[1- (3-Chlorophenyl) -5-methyl-1H-1,2,3-triazol-4-yl]acetic acid

Sign In for Pricing
View Details