Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Synaptophysin (SYP)

This Recombinant Bovine Synaptophysin (SYP) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Synaptophysin, Major synaptic vesicle protein p38

UniProt

P20488

Expression Region

1-313

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANK TKSDLNIEVEFEYPFRLHEVYFEAPTCQGDPKKIFLVGNYSSSAEFFVTVAVFAFLYSMG ALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKGM HVCHQPGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAP EKQPAPGDAYGQAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASSGGGGYGPQGDYGQQGY GPQGAPTSFSNQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUCKS1 Human Gene Knockout Kit (CRISPR)
KN401704 1 Kit

NUCKS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BACH1 Antibody
KC-3647-01 50 μL

BACH1 Antibody

Sign In for Pricing
View Details
BACH1 Antibody
KC-3647-02 100 µL

BACH1 Antibody

Sign In for Pricing
View Details
BACH1 Antibody
KC-3647-03 1 mL

BACH1 Antibody

Sign In for Pricing
View Details
Ethyl 5-Cyano-6-hydroxynicotinate
TRC-E179770-250MG 250 mg

Ethyl 5-Cyano-6-hydroxynicotinate

Sign In for Pricing
View Details
NCR1 Mouse Monoclonal Antibody [Clone ID: B-N40]
AM31279FC-N 1 mL (100 Tests)

NCR1 Mouse Monoclonal Antibody [Clone ID: B-N40]

Sign In for Pricing
View Details