Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter capsulatus Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Rhodobacter capsulatus Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

D5AV16

Expression Region

1-314

Origin

Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFAAMMVVAIGIDLALGWPDALYKRIGHPVTWIGALIARLEKGWNFKGRLRRLRGVLVA LAVIGTTVVIALAVQLWLPAGWPGVLIGGILAWPFVALRSMHDHVAAVAKPLIAGDLPGA RQAVSMIVGRDPSQLDQPGVARAALESLAENSSDGIVAPLFWGCVAGLPGIAGYKAINTL DSMIGHRTDRYEEFGWASARIDDLVNLIPARLTGLFFALASPCRARALAVMARDARSHRS PNAGWPEAAMAGALAVRLSGPRIYADRVANEPWLNGTAPDPRPADLARGLALYRRAMAGM TLVIGLVAVLWSVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-100 1x 100 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-500 1x 500 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1149), CF568 conjugate, 0.1mg/mL
BNC681149-500 1x 500 µL

CD71 (TFRC/1149), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details