Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein YIF1B (YIF1B)

This Recombinant Human Protein YIF1B (YIF1B) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Protein YIF1B, YIP1-interacting factor homolog B

UniProt

Q5BJH7

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHPAGLAAAAAGTPRLRKWPSKRRIPVSQPGMADPHQLFDDTSSAQSRGYGAQRAPGGLS YPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYV GRKLGLLFFPYLHQDWEVQYQQDTPVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDR FSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLMG LLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAAAEGVPVRGARNQLRMYLTMAVAAA QPMLMYWLTFHLVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STNL E013-297x105-PE-CRD/1 AC Signs
815919 Card of 1 Pictogram(s)

STNL E013-297x105-PE-CRD/1 AC Signs

Sign In for Pricing
View Details
MARK2 Antibody
orb1258898 100 µL

MARK2 Antibody

Sign In for Pricing
View Details
NMUR2 Polyclonal Antibody
MBS8567612-01 0.1 mL

NMUR2 Polyclonal Antibody

Sign In for Pricing
View Details
NMUR2 Polyclonal Antibody
MBS8567612-02 0.1 mL (AF405L)

NMUR2 Polyclonal Antibody

Sign In for Pricing
View Details
NMUR2 Polyclonal Antibody
MBS8567612-03 0.1 mL (AF405S)

NMUR2 Polyclonal Antibody

Sign In for Pricing
View Details
NMUR2 Polyclonal Antibody
MBS8567612-04 0.1 mL (AF610)

NMUR2 Polyclonal Antibody

Sign In for Pricing
View Details