Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Rhomboid domain-containing protein 1 (Rhbdd1)

This Recombinant Mouse Rhomboid domain-containing protein 1 (Rhbdd1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Rhomboid domain-containing protein 1, EC= 3.4.21.-

UniProt

Q8BHC7

Expression Region

1-315

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRRTRGINTGLLLLLSQVFQIGINNIPPVTLATLAVNVWFFLNPWKPLYHSCISVEKCY QQKDWQRLLLSPLHHGDDWHLYFNMVSMLWKGVKLERRLGSRWFAYVIATFSLLTGVVYL LLQFTVAELLNQPDFKRNCAVGFSGVLFALKVLSNHYCPGGFVNILGFPVPNRFACWAEL VAIHFCTPGTSFAGHLAGILVGLMYTQGPLKKIMDTCAGIFISHAGPSGQQNHFNNAGPS GYQNHYADGRPVTYDATYRNYDVYTAGLSEEEQLERALRASIWDRGNTRNGPMPYGFRLP PEEMRRQRLHRFDGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf32 3'UTR GFP Stable Cell Line
TU052798 1.0 mL

C12orf32 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Phosphotyrosine (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 3B12]
AM00125BT-N 100 µg

Phosphotyrosine (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 3B12]

Sign In for Pricing
View Details
CD27 Recombinant Antibody, Cy7 Conjugated
bsm-54318R-Cy7 100 µL

CD27 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Hsa-miR-658 miRNA Agomir
CMJ0441-01 5 nmol

Hsa-miR-658 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-658 miRNA Agomir
CMJ0441-02 10 nmol

Hsa-miR-658 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-658 miRNA Agomir
CMJ0441-03 20 nmol

Hsa-miR-658 miRNA Agomir

Sign In for Pricing
View Details