Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Rhomboid domain-containing protein 1 (Rhbdd1)

This Recombinant Mouse Rhomboid domain-containing protein 1 (Rhbdd1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Rhomboid domain-containing protein 1, EC= 3.4.21.-

UniProt

Q8BHC7

Expression Region

1-315

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRRTRGINTGLLLLLSQVFQIGINNIPPVTLATLAVNVWFFLNPWKPLYHSCISVEKCY QQKDWQRLLLSPLHHGDDWHLYFNMVSMLWKGVKLERRLGSRWFAYVIATFSLLTGVVYL LLQFTVAELLNQPDFKRNCAVGFSGVLFALKVLSNHYCPGGFVNILGFPVPNRFACWAEL VAIHFCTPGTSFAGHLAGILVGLMYTQGPLKKIMDTCAGIFISHAGPSGQQNHFNNAGPS GYQNHYADGRPVTYDATYRNYDVYTAGLSEEEQLERALRASIWDRGNTRNGPMPYGFRLP PEEMRRQRLHRFDGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Eukaryotic initiation factor 4A III (EIF4A3) ELISA kit
GTR10451626 96 Well

Goat Eukaryotic initiation factor 4A III (EIF4A3) ELISA kit

Sign In for Pricing
View Details
SEMA3A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
43342066 1.0 µg DNA

SEMA3A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
C9orf89 Polyclonal Antibody, Cy5 Conjugated
bs-15346R-Cy5 100 µL

C9orf89 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Mouse Polyclonal IFI44 Antibody
H00010561-B01P 0.05 mg

Mouse Polyclonal IFI44 Antibody

Sign In for Pricing
View Details
Coiled-Coil Domain Containing 106 (CCDC106) Antibody
abx240296 100 µg

Coiled-Coil Domain Containing 106 (CCDC106) Antibody

Sign In for Pricing
View Details
Human GPR111 Alexa Fluor 700 MAb (Clone 594519)
FAB6494S-100UG 100 µg

Human GPR111 Alexa Fluor 700 MAb (Clone 594519)

Sign In for Pricing
View Details