Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein FAM26D (Fam26d)

This Recombinant Mouse Protein FAM26D (Fam26d) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Protein FAM26D

UniProt

Q8CE93

Expression Region

1-315

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPDLNCISSSLLRSEPCINSLIAILTVCGQQLFSSYTFSCPCQVGKNFYYGSAFLVVPA LILLIAGYALRGQMWTVASEYCCCSCTPPYRRSSPLERRLACLMFFDITGRALVAPLTWL TVTLLTGTYYECAASEFASVDQYPMFANVTPSKREEMLAGFPCYTSAPSDVIPIRDEVAL LHRYQSQMLGWILVVLATIALLLSKCLARCCSPLTSLQHHYWTNHLHNERVLFEKAAEEH SQLLIRHRIKKVFGFVPGSEDIKHIRIPSCQDWREISVPNLLCVGDTSQGPYSFLGDRVV EENEEDRQEGIEMKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-500 1x 500 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-500 1x 500 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-100 1x 100 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-100 1x 100 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-500 1x 500 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details