Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rhomboid domain-containing protein 1 (RHBDD1)

This Recombinant Human Rhomboid domain-containing protein 1 (RHBDD1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Rhomboid domain-containing protein 1, EC= 3.4.21.-

UniProt

Q8TEB9

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCY QQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYL LLQFAVAEFMDEPDFKRSCAVGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVEL VAIHLFSPGTSFAGHLAGILVGLMYTQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSS GYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLS PEEMRRQRLHRFDSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG4B Blocking Peptide
MBS9617607-01 1 mg

ATG4B Blocking Peptide

Sign In for Pricing
View Details
ATG4B Blocking Peptide
MBS9617607-02 5x 1 mg

ATG4B Blocking Peptide

Sign In for Pricing
View Details
Recombinant Shewanella baltica Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS1024288 Inquire

Recombinant Shewanella baltica Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
PPLK/GFP+Puro-Smarca4 shRNA-1
PPL50092-3a 1 Each

PPLK/GFP+Puro-Smarca4 shRNA-1

Sign In for Pricing
View Details
Human anti-human IL-10 mAb (18)
A09D08-B2G 1 Each

Human anti-human IL-10 mAb (18)

Sign In for Pricing
View Details
IMP3 antibody
70R-4709 100 µL

IMP3 antibody

Sign In for Pricing
View Details