Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rhomboid domain-containing protein 1 (RHBDD1)

This Recombinant Human Rhomboid domain-containing protein 1 (RHBDD1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Rhomboid domain-containing protein 1, EC= 3.4.21.-

UniProt

Q8TEB9

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCY QQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYL LLQFAVAEFMDEPDFKRSCAVGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVEL VAIHLFSPGTSFAGHLAGILVGLMYTQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSS GYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLS PEEMRRQRLHRFDSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella boydii serotype 4 Polyribonucleotide nucleotidyltransferase (pnp), partial
MBS1483055 Inquire

Recombinant Shigella boydii serotype 4 Polyribonucleotide nucleotidyltransferase (pnp), partial

Sign In for Pricing
View Details
WRKY9 Antibody
PHY7531A 150 μg

WRKY9 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal GDF-3 Antibody [Janelia Fluor 549]
NBP2-98686JF549 0.1 mL

Rabbit Polyclonal GDF-3 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Human Peptide YY (PYY) ELISA Kit
orb775536-01 48 Tests

Human Peptide YY (PYY) ELISA Kit

Sign In for Pricing
View Details
Human Peptide YY (PYY) ELISA Kit
orb775536-02 96 Tests

Human Peptide YY (PYY) ELISA Kit

Sign In for Pricing
View Details
5- (3,5-Dicarboxyphenyl) -2-fluorobenzoic acid
434414-01 100 mg

5- (3,5-Dicarboxyphenyl) -2-fluorobenzoic acid

Sign In for Pricing
View Details