Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q8XLK2

Expression Region

1-315

Origin

Clostridium perfringens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIIIGYVLDLIIGDPNNPYHPIRYIGKLASNMEKLWRKVFKKNLKIAGFFAWLFIVFI TFGVTLGIVHIANKINPILGTVVSGILIYFCISAKGLKVEGLKVIKILKEGDIVKARKQL SYIVGRDTENLDEEAIVRAVVETVAENMSDGIIAPLFFAGIGGAPLAFLYKAVNTCDSMF GYKNEKYKDFGFFSAKLDDVFNYIPARLTAYLIVISSFILRLNCKNIFKIYKRDRYNHSS PNSAHPEAAVAGALGIRLGGANYYFGKLVEKPTIGDAKKKIEISDVYKTNNILGMVSFLG MVVALIIRCILEVII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A 484954
B5618-10 10 mg

A 484954

Sign In for Pricing
View Details
ZC3H8 (ZC3HDC8) discontinued
515938 100 µg

ZC3H8 (ZC3HDC8) discontinued

Sign In for Pricing
View Details
Cog7 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3699602 1.0 µg DNA

Cog7 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
GSDMC Rabbit pAb
A14550-01 20 µL

GSDMC Rabbit pAb

Sign In for Pricing
View Details
GSDMC Rabbit pAb
A14550-02 100 μL

GSDMC Rabbit pAb

Sign In for Pricing
View Details
GSDMC Rabbit pAb
A14550-03 500 μL

GSDMC Rabbit pAb

Sign In for Pricing
View Details