Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Post-GPI attachment to proteins factor 2 (PGAP2)

This Recombinant Human Post-GPI attachment to proteins factor 2 (PGAP2) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1

UniProt

Q9UHJ9

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYQVPLPLDRDGTLVRLRFTMVALVTVCCPLVAFLFCILWSLLFHFKETTATHCGATPCR MFSAASQPLDPDGTLFRLRFTAMVWWAITFPVFGFFFCIIWSLVFHFEYTVATDCGVPNY LPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCSCYRPLCRLNFGL NVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKS YSWKQRLFIINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFG NKELLITSQPEEKRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr278 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7437307 1.0 µg DNA

Olr278 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
THT-74-427-10 Pre-sized Labels for Printers
030348 10000 Roll (10000 Label (s) x 1 Roll)

THT-74-427-10 Pre-sized Labels for Printers

Sign In for Pricing
View Details
Ovotransferrin, Allergen Gal d III, Conalbumin, Serum transferrin
327043-01 50 µg

Ovotransferrin, Allergen Gal d III, Conalbumin, Serum transferrin

Sign In for Pricing
View Details
Ovotransferrin, Allergen Gal d III, Conalbumin, Serum transferrin
327043-02 100 µg

Ovotransferrin, Allergen Gal d III, Conalbumin, Serum transferrin

Sign In for Pricing
View Details
MEK1 (MAP2K1) Mouse Monoclonal Antibody [Clone ID: LBI2F1]
AMM13615V 100 µL

MEK1 (MAP2K1) Mouse Monoclonal Antibody [Clone ID: LBI2F1]

Sign In for Pricing
View Details
Sheep Antigen KI 67 (Ki 67) ELISA kit
GTR10384772 96 Well

Sheep Antigen KI 67 (Ki 67) ELISA kit

Sign In for Pricing
View Details